PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678403501
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family ZF-HD
Protein Properties Length: 235aa    MW: 26695.9 Da    PI: 9.9833
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678403501genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer93.22.3e-2951106359
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                  +v Y+eCl+NhAa++G h+vDGCgEfmp+ g+egta+ l CaAC+CHRnFHR+ ++ 
    678403501  51 SVAYRECLRNHAAAMGRHVVDGCGEFMPT-GREGTAEELLCAACNCHRNFHRKGTDG 106
                  689*************************8.999********************8765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.5E-2852103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.3E-2754102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.74954103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-1854113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.608.1E-26152218IPR009057Homeodomain-like
SuperFamilySSF466898.63E-16153215IPR009057Homeodomain-like
TIGRFAMsTIGR015654.0E-25158214IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MERRRRDQDG HDSGYASAAG FFSPETSPPP RRNAGFPDPD PEILAPASGA SVAYRECLRN  60
HAAAMGRHVV DGCGEFMPTG REGTAEELLC AACNCHRNFH RKGTDGEYYP HRNPTSYNTH  120
RTPPLASSRG NSVGAAAESS SEDLNMLRGA RARRDKKKKR FRTKFSPEQK EQMREFAEKL  180
GWKVQRQDEE GVQDFCDRNG VTKQVFKVWM HNNKRLRKTM TPEKILFPRN KFPEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-201592141873ZF-HD homeobox family protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
116ERRRRD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099626.18e-66PREDICTED: zinc-finger homeodomain protein 6
SwissprotQ9ZPW71e-54ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLS8DUD25e-67S8DUD2_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc02g085160.1.11e-59(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.16e-48homeobox protein 24